Skip to main content

Advertisement

Table 1 Amino acid sequence of the synthetic peptides identified by phage display

From: Identification of glycosaminoglycan binding regions in the Plasmodium falciparum encoded placental sequestration ligand, VAR2CSA

Peptide ID Protein ID Sequence
P1 3D7 – DBL1X ENQKNKYTELYQQNKC
P2a 3D7 – DBL2X GKKTQELKNIRTNSELLKEWIIAAFHEGKC
P2b FCR3 – DBL2X EDVKDINFDTKEKFLAGCLIVSFHEGKC
P2c 3D7 – DBL2X LKPSHEKKNDDNGKKLCKAC
P3 3D7 – DBL3X IKKIIEKGTTKQNGKTVGSGAEN
P4 3D7 – DBL4ε IKNKNDITNAKKELLETLQIVAERE
P5 3D7 – DBL5ε ILKGAQSEGKFLGNYYNEDKDKEKALEAMC
PC P. falciparum Potassium pump WRRDTYNMIWGFNKIPTYIYNMLLILLSTSYID