Skip to main content

Table 2 Summary of information and bioinformatics analyses of the 10 selected peptides

From: An evolutionary approach to identify potentially protective B cell epitopes involved in naturally acquired immunity to malaria and the role of EBA-175 in protection amongst denizens of Bolifamba, Cameroon

Level Gene ID Product
Annotated GO component term Location aa
Code Peptide aa sequence Length Maximum probability of B-cell epitope by Bepipred
6 PF3D7_1112000 Conserved Plasmodium protein, unknown function Integral to membrane, plasma membrane 54–72 PF6-111 KFNYDPFYSNWEKKNIQDS 19 0.52
6 PF3D7_0601900 Conserved Plasmodium protein, unknown function Maurer’s cleft 76–98 PF6-060 MSKHYEDDDDDDDYQPPRHSSLP 23 0.68
4 PF3D7_1313500 Conserved Plasmodium membrane protein, unknown function extracellular region, membrane 740–769 PF4-131 KSHHKNIHNNNTVEYNSEEDGNSKSKLSKD 30 0.7
4 PF3D7_1233400 Conserved Plasmodium membrane protein, unknown function Cell surface, extracellular region 489–513 PF4-123 RKKIYTHKTTRKKHKDNPDYEKALL 25 0.71
4 PF3D7_1437500 Conserved Plasmodium membrane protein, unknown function Integral to membrane, plasma membrane 7–36 PF4-143 VKIDNGESDEYNSTNQSPRKLNDSSGLSKK 30 0.75
4 PF3D7_1138200 Conserved Plasmodium protein, unknown function Integral to membrane, plasma membrane 7–23 PF4-113 ICGRPLRNGGTAPLIYN 17 0.58
2 PF3D7_0209600 Transporter, putative Integral to membrane 6–27 PF2-020 RSSVTRTSNEESNEDDKNCVNV 22 0.561
2 PF3D7_1471200 Inorganic anion exchanger, inorganic anion antiporter (SulP) Integral to plasma membrane, membrane 65–84 PF2-147 IKWGWGFTNTPKETSKYYIN 20 0.72
2 PF3D7_1250200 Conserved Plasmodium membrane protein, unknown function Apicoplast, integral to membrane, membrane 445–474 PF2-125 DKDDNKEDDNNDDDNNDNHHNNDDNNDDHH 30 0.65
2 PF3D7_1125000 Conserved Plasmodium protein, unknown function Apicoplast, plasma membrane 129–148 PF2-112 FNVEEMGTGKTDDIHTPIEV 20 0.6
  1. Level is with respect to Fig. 2. aa amino acid, Code peptide fragment name