Level | Gene ID |
Product description | Annotated GO component term |
Location aa position | Code | Peptide aa sequence | Length | Maximum probability of B-cell epitope by Bepipred |
---|---|---|---|---|---|---|---|---|
6 | PF3D7_1112000 | Conserved Plasmodium protein, unknown function | Integral to membrane, plasma membrane | 54–72 | PF6-111 | KFNYDPFYSNWEKKNIQDS | 19 | 0.52 |
6 | PF3D7_0601900 | Conserved Plasmodium protein, unknown function | Maurer’s cleft | 76–98 | PF6-060 | MSKHYEDDDDDDDYQPPRHSSLP | 23 | 0.68 |
4 | PF3D7_1313500 | Conserved Plasmodium membrane protein, unknown function | extracellular region, membrane | 740–769 | PF4-131 | KSHHKNIHNNNTVEYNSEEDGNSKSKLSKD | 30 | 0.7 |
4 | PF3D7_1233400 | Conserved Plasmodium membrane protein, unknown function | Cell surface, extracellular region | 489–513 | PF4-123 | RKKIYTHKTTRKKHKDNPDYEKALL | 25 | 0.71 |
4 | PF3D7_1437500 | Conserved Plasmodium membrane protein, unknown function | Integral to membrane, plasma membrane | 7–36 | PF4-143 | VKIDNGESDEYNSTNQSPRKLNDSSGLSKK | 30 | 0.75 |
4 | PF3D7_1138200 | Conserved Plasmodium protein, unknown function | Integral to membrane, plasma membrane | 7–23 | PF4-113 | ICGRPLRNGGTAPLIYN | 17 | 0.58 |
2 | PF3D7_0209600 | Transporter, putative | Integral to membrane | 6–27 | PF2-020 | RSSVTRTSNEESNEDDKNCVNV | 22 | 0.561 |
2 | PF3D7_1471200 | Inorganic anion exchanger, inorganic anion antiporter (SulP) | Integral to plasma membrane, membrane | 65–84 | PF2-147 | IKWGWGFTNTPKETSKYYIN | 20 | 0.72 |
2 | PF3D7_1250200 | Conserved Plasmodium membrane protein, unknown function | Apicoplast, integral to membrane, membrane | 445–474 | PF2-125 | DKDDNKEDDNNDDDNNDNHHNNDDNNDDHH | 30 | 0.65 |
2 | PF3D7_1125000 | Conserved Plasmodium protein, unknown function | Apicoplast, plasma membrane | 129–148 | PF2-112 | FNVEEMGTGKTDDIHTPIEV | 20 | 0.6 |