An evolutionary approach to identify potentially protective B cell epitopes involved in naturally acquired immunity to malaria and the role of EBA-175 in protection amongst denizens of Bolifamba, Cameroon

Nyasa, Raymond B.; Kimbi, Helen K.; Zofou, Denis; DeBarry, Jeremy D.; Kissinger, Jessica C.; Titanji, Vincent P. K.

doi:10.1186/s12936-016-1337-z

Table 2 Summary of information and bioinformatics analyses of the 10 selected peptides

From: An evolutionary approach to identify potentially protective B cell epitopes involved in naturally acquired immunity to malaria and the role of EBA-175 in protection amongst denizens of Bolifamba, Cameroon

Level	Gene ID	Product description	Annotated GO component term	Location aa position	Code	Peptide aa sequence	Length	Maximum probability of B-cell epitope by Bepipred
6	PF3D7_1112000	Conserved Plasmodium protein, unknown function	Integral to membrane, plasma membrane	54–72	PF6-111	KFNYDPFYSNWEKKNIQDS	19	0.52
6	PF3D7_0601900	Conserved Plasmodium protein, unknown function	Maurer’s cleft	76–98	PF6-060	MSKHYEDDDDDDDYQPPRHSSLP	23	0.68
4	PF3D7_1313500	Conserved Plasmodium membrane protein, unknown function	extracellular region, membrane	740–769	PF4-131	KSHHKNIHNNNTVEYNSEEDGNSKSKLSKD	30	0.7
4	PF3D7_1233400	Conserved Plasmodium membrane protein, unknown function	Cell surface, extracellular region	489–513	PF4-123	RKKIYTHKTTRKKHKDNPDYEKALL	25	0.71
4	PF3D7_1437500	Conserved Plasmodium membrane protein, unknown function	Integral to membrane, plasma membrane	7–36	PF4-143	VKIDNGESDEYNSTNQSPRKLNDSSGLSKK	30	0.75
4	PF3D7_1138200	Conserved Plasmodium protein, unknown function	Integral to membrane, plasma membrane	7–23	PF4-113	ICGRPLRNGGTAPLIYN	17	0.58
2	PF3D7_0209600	Transporter, putative	Integral to membrane	6–27	PF2-020	RSSVTRTSNEESNEDDKNCVNV	22	0.561
2	PF3D7_1471200	Inorganic anion exchanger, inorganic anion antiporter (SulP)	Integral to plasma membrane, membrane	65–84	PF2-147	IKWGWGFTNTPKETSKYYIN	20	0.72
2	PF3D7_1250200	Conserved Plasmodium membrane protein, unknown function	Apicoplast, integral to membrane, membrane	445–474	PF2-125	DKDDNKEDDNNDDDNNDNHHNNDDNNDDHH	30	0.65
2	PF3D7_1125000	Conserved Plasmodium protein, unknown function	Apicoplast, plasma membrane	129–148	PF2-112	FNVEEMGTGKTDDIHTPIEV	20	0.6

Level is with respect to Fig. 2. aa amino acid, Code peptide fragment name

Back to article page

ISSN: 1475-2875

Contact us

Submission enquiries: journalsubmissions@springernature.com

Malaria Journal

Contact us