Skip to main content

Table 1 Alignment of pLDH epitope among Plasmodium species

From: Performance of coumarin-derived dendrimer-based fluorescence-linked immunosorbent assay (FLISA) to detect malaria antigen

Species Epitope region in LDH Identity GenBank accession no.
P. vivax 75 FTKAPGKSDKEWNRDDLLPLNNKIMIEIGGH 105 31/31(100%) AAS77573.1
P. falciparum 61 FTKAPGKSDKEWNRDDLLPLNNKIMIEIGGH 91 31/31(100%) AEX28368.1
P. knowlesi 82 FTKAPGKSDKEWNRDDLLPLNNKIMIEIGGH 112 31/31(100%) AEL88505.1
P. yoelii 17XNL 82 FTKAPGKSDKEWNRDDLLPLNNKIMIEIGGH 112 31/31(100%) XP724101.1
P. berghei ANKA 82 FTKAPGKSDKEWNRDDLLPLNNKIMIEIGGH 112 31/31(100%) XP679401.1
P. malariae 75 FTKVPGKSDKEWNRDDLLPLNNKIMIEIGGH 105 30/31(97%) AAS77572.1
P. ovale 75 FTKAPGKSDKEWNRDDLLPLNNKIMIEIGGH 105 31/31(100%) AAS77571.1
Eimeria maxima 88 TKIPGKSDKEWSRMDLLPVNIKIMREVGG 116 22/29(76%) AAN38977.1
Toxoplasma gondii 86 LTKVPGKSDKEWSRNDLLPFNAKIIREVA 114 19/29(66%) XP002368488.1
Homo sapiens 98 AGARQQEGESRLNLVQRN123 7/31 (23%) CAE11711
  1. Plasmodium LDH epitope (FTKAPGKSDKEWNRDDLLPLNNKIMIEIGGH) is highly conserved among seven Plasmodium spp. and the percentage of sequence identity is determined by epitope alignments across the listed in NCBI.